PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G132100.1
Common NamePHAVU_003G132100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 312aa    MW: 35713.8 Da    PI: 6.2472
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G132100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+ Ed++l ++++ +G g+W+  +++ g++R++k+c++rw++yl
  Phvul.003G132100.1 14 RGAWTAHEDKILREYIRVHGEGRWRNLPKRAGLKRCGKSCRLRWLNYL 61
                        89********************************************97 PP

2Myb_DNA-binding52.98.3e-1767111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+ T +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
  Phvul.003G132100.1  67 RGNITSDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                         7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.246961IPR017930Myb domain
SuperFamilySSF466894.3E-2812108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001671.48E-101661No hitNo description
PROSITE profilePS5129425.0162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2465116IPR009057Homeodomain-like
SMARTSM007171.6E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
CDDcd001671.41E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTAH EDKILREYIR VHGEGRWRNL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TSDEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKKVKDGH  120
KTSTTCRRPS NENSTQNPMS LPKDSHLVRT KATKCTKVFF PHPSMLQLPN KSEEEEEHEE  180
EEEERIVDAV VSDQMELTTN NNGFLSFPNE EKELSTDMLT DFNVGDICLS DLLDSDFSNI  240
YNFTCTTNAV HNNNNDNQLF SPCSDQPYPV CSDELLKNWK QSNFADETNA SNNLHSFISF  300
LETSEERVGQ S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150343e-89AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154596.10.0hypothetical protein PHAVU_003G132100g
SwissprotQ9FJA22e-62TT2_ARATH; Transcription factor TT2
TrEMBLV7CBD90.0V7CBD9_PHAVU; Uncharacterized protein
STRINGGLYMA13G16890.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.13e-63MYB family protein